I'm using 2012 Microsoft Visual Basic for Application 7.1
I have a bunch of strings like "85,123kg" , "123,05kg", "11,21kg".
And I want to convert it to Integers like 85, 123, 11
How can I do it?
Now I'm trying to For every string and when "," detects - Exit for And all numbers before the "," add to new string
But this looks awfull
If InStr(text, "kg") > 0 Then
For charIndex = 1 To text.Length
If text(charIndex) Like "," Then
Exit For
Else
Microsoft Visual Basic for Application 7.1 has a function named Val that does exactly that. You would use it as Val("85,123kg") (or Val(text) where text is equal to "85,123kg") and obtain the integer 85.
The Val function tries to extract a number from the string starting from the left. It will ignore whitespace (spaces and tabs) and linefeeds.
Reading stops at the first character that cannot be recognized as part of a number. Symbols and characters that are often considered parts of numeric values, such as dollar signs and commas, are not recognized.
Related
Hey so i have a school project in which i need to split a massive word into smaller words.
This is the massive sequence of letters :
'GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASEDLKKHGTVVLTALGGILKKKEGH
HEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHRPGDFGADAQGAMTKALELFRNDIAAKYKELGFQG'
and then i need to split it into other smaller separate parts of itself which would look like this :
'GLSDGEWQQVLNVWGK'
'VEADIAGHGQEVLIR'
'LFTGHPETLEK'
'FDK'
'FK'
'HLK'
'TEAEMK'
'ASEDLK'
'K'
'HGTVVLTALGGILK'
'K'
'K'
'EGHHEAELKPLAQSHATK'
'HK'
'IPIK'
'YLEFISDAIIHVLHSK'
'HRPGDFGADAQGAMTK'
'ALELFR'
'NDIAAK'
'YK'
'ELGFQG'
i have no idea how to start on this if you could help pls and thanks
Different digestion enzymes cut at different positions within a protein sequence; the most commonly used one is trypsin. It follows the following rules: 1) Cuts the sequence after an arginine (R) 2) Cuts the sequence after a lysine (K) 3) Does not cut if lysine (K) or arginine (R) is followed by proline (P).
Okay, hooray, rules! Let's turn this into pseudo-code to describe the same algorithm in a half-way state between the original prose and code. (While a Regex.Split approach would still work, this might be a good time to explore some more fundamentals.)
let the list of words be an empty array
let current word be the empty string
for each letter in the input:
if the letter is R or K and the next letter is NOT P then:
add the letter to the current word
save the current word to the list of words
reset the current word to the empty string
otherwise:
add the letter to the current word
if after the loop the current word is not the empty string then:
add the current word to the list of words
Then let's see how some of these translate. This is incomplete and quite likely contains minor errors1 beyond that which has been called out in comments.
Dim words As New List(Of String)
Dim word = ""
' A basic loop works suitably for string input and it can also be
' modified for a Stream that supports a Peek of the next character.
For i As Integer = 0 To input.Length - 1
Dim letter = input(i)
' TODO/FIX: input(i+1) can access an element off the string. Reader exercise.
If (letter = "R"C OrElse letter = "K"C) AndAlso Not input(i+1) = "P"C
' StringBuilder is more efficient for larger strings
Set word = word & letter
words.Add(word) ' or perhaps just WriteLine the word somewhere?
Set word = ""
Else
Set word = word & letter
End If
Next
' TODO/FIX: consider when last word is not added to words list yet
1As I use C# (and not VB.NET) the above code comes warranty Free. Here are some quick reference links I used to 'stitch' this together:
https://www.dotnetperls.com/loop-string-vbnet
https://learn.microsoft.com/en-us/dotnet/visual-basic/programming-guide/language-features/operators-and-expressions/concatenation-operators
https://www.dotnetperls.com/list-vbnet
https://learn.microsoft.com/en-us/dotnet/visual-basic/language-reference/statements/dim-statement
How do you declare a Char literal in Visual Basic .NET?
My software creates PAIN001.XML files directly from an Access financial database. The decimal separator must always be a dot. The numbers are formatted with:
MyText = Format(MyNumber, "#0.00")
However, the format string's dot is automatically replaced by the system decimal separator, which might be "," instead of "." !
In Excel there are easy solutions, for example:
Application.DecimalSeparator = "."
...
However, MS Access doesn't recognize this application property.
Is there a simple way to define a decimal separator within Access vba code ?
Of course, one can create a function which scans each MyText number for wrong decimal separators and replaces them with a dot, but this function would have to be called separately for each number, slowing down the code quite a lot…
The decimal separator must always be a dot.
Then use Str:
MyText = Str(MyNumber)
To convert such a string to a number use Val:
MyNumber = Val(MyText)
I guess the problem is not solveable with the decimal separator Application.DecimalSeparator = ".", even if it was supported by the Access library. It is a rather complicated issue, for the non-US users, as we are used to have , as a decimal separator.
In general, VBA considers only . as a decimal separator. Without taking care of the application default separator, the location of the user and their settings. Thus, some interesting cases could happen:
Sub TestMe()
Dim myText As String
myText = "123,42"
Debug.Print Replace(Format(myText, "#0.00"), ",", ".")
End Sub
A possible solution, that I have implemented some time ago was to use Replace() and to replace as in the gif above. It could be a bit slow indeed, but taking into account the usage of VBA and Access, extreme speed is not something the app could achieve anyway.
I use this code to check if a String is in another String:
If StringData(1).Contains("-SomeText2.") Then
'some code
End If
'StringData(1) looks like this:
'-SomeText1.1401-|-SomeText2.0802-|-SomeText3.23-|-SomeText4.104-|
'In case I look for -SomeText1. I need 1401
'In case I look for -SomeText2. I need 0802
'In case I look for -SomeText3. I need 23
'In case I look for -SomeText4. I need 104
I first check if -SomeText2. is in StringData(1), and if it is, I need to get the next part of the text: 0802 which is the part I don't know how to do, how can I do it?
All the strings are separated by | and all substrings start and end with - and have a . separating the first part from the second. I check all the strings starting with - and ending with . because there are some with - and | in the middle, so Split function won't work.
Those strings change quite often, so I need something to check it no matter the length of the strings.
I would just split the string up and get the text between "." and "-" when the search text is found like this:
Dim str As String = "-SomeText1.1401-|-SomeText2.0802-|-SomeText3.23-|-SomeText4.104-"
Dim searches() As String = {"-SomeText1", "-SomeText2", "-SomeText3", "-SomeText4"}
For Each search As String In searches
For Each value As String In str.Split(CChar("|"))
If value.Contains(search) Then
Dim partIwant As String = value.Substring(value.IndexOf(".") + 1, value.Length - value.IndexOf(".") - 2)
MsgBox(partIwant)
'Outputs: 1401, 0802, 23, 104
Exit For
End If
Next
Next
In this example, we just use Contains() to see if our search string is present or not...we can't actually use that function to get any further information because all it returns is a True or False. So once we know that our string has been found, it's just a matter of some string manipulation to grab the text between the "." and "-" characters. IndexOf() will get us the index of the period, and then we just pull the text between there and the last character of the string.
Your question has nothing to do with WPF, so the tag and title are misleading.
To solve your problem, you should use String.IndexOf(string) instead of String.Contains(string). That tells you at which position the given string starts. If that value is -1, it means that the original string does not contain your search string at all.
Once you have that starting index, you can use String.IndexOf(string, int) to search for the next occurrence of -, so you know where the entry stops. The second parameter tells it at which index it should start the search, and in this case you should start the search at the index where you found your first match.
Now that you know the starting index of your match, the end index of the entry and the length of your search string, you can put those together and easily use String.Substring(int, int) to get the part of the string that you are interested in.
That's the straight forward, naive solution. A more sophisticated solution would simply build a regular expression for the search string that is built in a way that the part you are interested in is included in the capture group. But that's a more elaborate topic.
To start here is an example of a line I am trying to manipulate:
trait slot QName(PrivateNamespace("*", "com.company.assembleegameclient.ui:StatusBar"), "_-0IA") type QName(PackageNamespace(""), "Boolean") value False() end
I wrote a code that will go through and read through each line and stop at the appropriate line. What I am trying to achieve now is to read through the characters and save just the
_-0IA
to a new string. I tried using Trim(), Replace(), and indexof so far but I am having a ton of difficulties because of the quotation marks. Has anyone deal with this issue before?
Assuming your source string will always follow a strict format with only some data changes, something like this might work:
'Split the string by "," and extract the 3rd element. Trim the space and _
quotation mark from the front and extract the first 5 characters.
Dim targetstr As String = sourcestr.Split(","c)(2).TrimStart(" """.ToCharArray).Substring(0, 5)
If the length of the target string is variable it can be done like this:
Dim temp As String = teststr.Split(","c)(2).TrimStart(" """.ToCharArray)
'Use the index of the next quotation mark instead of a fixed length
Dim targetstr As String = temp.Substring(0, temp.IndexOf(""""c))
Hey guys I'm stuck with this question. Please help.
I want to write a program that can extract alphabetical characters and special characters from an input string. An alphabetical character is any character from "a" to "z"(capital letters and numbers not included") a special character is any other character that is not alphanumerical.
Example:
string = hello//this-is-my-string#capetown
alphanumerical characters = hellothisismystringcapetown
special characters = //---#
Now my question is this:
How do I loop through all the characters?
(the for loop I'm using reads like this for x = 0 to strname.length)...is this correct?
How do I extract characters to a string?
How do I determine special characters?
any input is greatly appreciated.
Thank you very much for your time.
You could loop through each character as follows:
For Each _char As Char In strname
'Code here
Next
or
For x as integer = 0 to strname.length - 1
'Code here
Next
or you can use Regex to replace the values you do not need in your string (I think this may be faster but I am no expert) Take a look at: http://msdn.microsoft.com/en-us/library/xwewhkd1.aspx
Edit
The replacement code will look something as follows although I am not so sure what the regular expression (variable called pattern currently only replacing digits) would be:
Dim pattern As String = "(\d+)?" 'You need to update the regular expression here
Dim input As String = "123//hello//this-is-my-string#capetown"
Dim rgx As New Regex(pattern)
Dim result As String = rgx.Replace(input, "")
Since you need to keep the values, you'll want to loop through your string. Keeping a list of characters as a result will come in handy since you can build a fresh string later. Then take advantage of a simple Regex test to determine where to place things. The psuedo code looks something like this.
Dim alphaChars As New List(Of String)
Dim specialChars As New List(Of String)
For Each _char As Char in testString
If Regex.IsMatch(_char, "[a-z]")) Then
alphaChars.Add(_char)
Else
specialChars.Add(_char)
End If
Next
Then If you need to dump your results into a full string, you can simply use
String.Join(String.Empty, alphaChars.ToArray())
Note that this code makes the assumption that ANYTHING else than a-z is considered a special character, so if needs be you can do a second regular expression in your else clause to test for you special characters in a similar manner. It really depends on how much control you have over the input.