This is my sample input file:
xxxxx,12345,yy,ABN,ABE,47,20171018130030,122021010147421,2,IN,3,13,9741588177,32
xxxxxx,9741588177,yy,ABN,ABE,54,20171018130030,122025010227014,2,IN,3,15,12345,32
I want to compare 2 consecutive lines in this file with this condition:
The 12th field of the 1st line and 12th field of the 2nd line must be 13 and 15, respectively.
If the conditions in point 1 are met, then the 2nd field of line 1 (which has the 12th field value as 13) must match the 13th field of line 2 (which has the 12th field as 15).
The file contains many such lines where the above condition is not met, I would like to print only those lines which meet conditions 1 and 2.
Any help in this regard is greatly appreciated!
It's not clear if you want to compare the lines in groups of 2 (ie, compare lines 1 and 2, and then lines 3 and 4) or serially (ie, compare lines 1 and 2, and then 2 and 3). For the latter:
awk 'NR > 1 && prev_12 == 13 && $12 == 15 &&
prev_2 == $13 {print prev; print $0}
{prev=$0; prev_12=$12; prev_2=$2}' FS=, input-file
For the former, add the condition NR % 2 == 0 . (I'm assuming you intended to mention that fields are comma separated, which appears to be the case judging by the input.)
Wish you'd used a few more lines of sample input and provided expected output so we're not all just guessing but MAYBE this is what you want to do:
$ cat tst.awk
BEGIN { FS="," }
(p[12] == 13) && ($12 == 15) && (p[2] == $13) { print p[0] ORS $0 }
{ split($0,p); p[0]=$0 }
$ awk -f tst.awk file
xxxxx,12345,yy,ABN,ABE,47,20171018130030,122021010147421,2,IN,3,13,9741588177,32
xxxxxx,9741588177,yy,ABN,ABE,54,20171018130030,122025010227014,2,IN,3,15,12345,32
another awk
$ awk -F, '$12==13 {p0=$0; p2=$2; c=1; next}
c&&c-- && $12==15 && p2==$13 {print p0; print}' file
start capturing only when the initial match on $12 of the first line.
c&&c-- is a smart counter (count-down here), which will stop at 0 (due to first c before the ampersand). Ed Morton has a post with a lot more examples of the smart counters
Related
I have a file which looks like this:
>4RYF_1
MAENTKNENITNILTQKLIDTRTVLIYGEINQELAEDVSKQLLLLESISNDPITIFINSQGGHVEAGDTIHDMIKFIKPTVKVVGTGWVASAGITIYLAAEKENRFSLPNTRYMIHQPAGGVQGQSTEIEIEAKEIIRMRERINRLIAEATGQSYEQISKDTDRNFWLSVNEAKDYGIVNEIIENRDGLKMASWSHPQFEK
>4RYF_2
MNLIPTVIEQTSRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLDAQDPEKDIFLYINSPGGSISAGMAIYDTMNFVKADVQTIGMGMAASMGSFLLTAGANGKRFALPNAEIMIHQPLGGAQGQATEIEIAARHILKIKERMNTIMAEKTGQPYEVIARDTDRDNFMTAQEAKDYGLIDDIIINKSGLKGHHHHHH
I want to keep the sequence and previous line only if the sequence has a given length. For selecting only lines with that condition I use:
awk 'length($0) > 50 && length($0) <=800)' sample.txt
But how can I keep lines starting with > as well if this condition is met?
Yet another awk solution:
awk '/^>/ { header = $0; next } length > 50 && length <= 800 { print header ORS $0 }'
Would you please try the following:
awk -v RS='>' -F'\n' '
length($2) > 50 && length($2) <= 800 {printf ">%s", $0}
' sample.txt
Assigning RS to '>' tells awk to split the file on > into records,
treating the header line and the sequence line in the same record.
Assigning FS to '\n' splits the record to the header and
sequence, each assigning $1 to the header and $2 to the sequence.
As the leading > is chopped off as a delimiter, we need to prepend it
when printing the matched records.
Here is one-liner:
LANG=C grep -B1 '^.\{51,800\}$' < sample.txt
The command was really slow with LANG=en_US.UTF-8 that I set by default, so using LANG=C instead.
man grep tells you that '-B NUM' means ' Print NUM lines of leading context before matching lines.'.
'^' means start of line
'.' means any character
'{51,800}' means we want between 51 and 800 of the previous thing
'$' means end of line.
Or in other words, we want to match lines that are between 51 and 800 characters, and print it and the previous line.
A potential solution with AWK is:
awk '!/^>/ {next}; {getline s}; length(s) > 50 && length(s) <= 800 { print $0 "\n" s }' example.fasta
e.g. if example.fasta contains
>4RYF_1
WLSVNEAKDYGIVNEIIENRDGLKMASWSHPQFEK
>4RYF_2
MNLIPTVIEQTSRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLDAQDPEKDIFLYINSPGGSISAGMAIYDTMNFVKADVQTIGMGMAASMGSFLLTAGANGKRFALPNAEIMIHQPLGGAQGQATEIEIAARHILKIKERMNTIMAEKTGQPYEVIARDTDRDNFMTAQEAKDYGLIDDIIINKSGLKGHHHHHH
>1000_chars
YiJOgeCApTkcJWxIuvooOxuqVnPdSLtOQmUfnzpBvcpYKyCvelFwKgMchYFnlvuZwVxNcnSvGcACsMywDQVvYBAiaIesQkLkYNsExRbqKPZIPnCRMAFHLmIzxIBqLwoNEPSKMZCTpwbbQCNrHSrbDMtCksTjvQsMeAkoudRGUJnPpQTEzwwnKoZBHtpMSIQBfYSPDYHwKktvCiFpewrsdDTQpqBajOWZkKURaKszEqDmdYMkzSAkMtlkXPfHroiTbyxZwzvrrMSXMRSavrBdgVYZanudjacRHWfpErJMkomXpzagXIzwbaeFgAgFnMxLuQHsdvZysqAsngkCZILvVLaFpkWnOpuYensROwkhwqUdngvlTsXBoCBwJUENUFgVdnSnxVOvfksyiabglFPqmSwhGabjNZiWGyvktzSDOQNGlEvoxhJCAOhxVAtZfyimzsziakpzfIszSWYVgKZTHatWSfttHYTkvgafcsVmitfEfQDuyyDAAAoTKpuhLrnHVFKgmEsSgygqcNLQYkpnhOosKiZJKpDolXcxAKHABtALqVXoVcSHpskrpWPrkkZLTpUXkENhnesmoQjonLWxkpcuJrOosXKNTDNuZaWIEtrDILXsIFTjAnrnwJBoirgNHcDURwDIzAXJSLPLmWkurOhWSLPrIOyqNvADBdIFaCGoZeewKleBHUGmKFWFcGgZIGUdOHwwINZqcOClPAjYaLNdLgDsUNCPwKMrOXJEyPvMRLaTJGgxzeoLCggJYTVjlJpyMsoCRZBDrBDckNMhJSQWBAxYBlqSpXnpmLeEJYirwjfCqZGBZdgkHzWGoAMxgNKHOAvGXsIbbuBjeeORhZaIrruBwDfzgTICuwWCAhCPqMqkHrxkQMZbXUIavknNhuIycoDssXlOtbSWsxVXQhWMyDQZWDlEtewXWKBPUcHDYWWgyOerbnoAxrnpsCulOxqxdywFJFoeWNpVGIPMUJSWwvlVDWNkjIBMlXPi
It will only print
>4RYF_2
MNLIPTVIEQTSRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLDAQDPEKDIFLYINSPGGSISAGMAIYDTMNFVKADVQTIGMGMAASMGSFLLTAGANGKRFALPNAEIMIHQPLGGAQGQATEIEIAARHILKIKERMNTIMAEKTGQPYEVIARDTDRDNFMTAQEAKDYGLIDDIIINKSGLKGHHHHHH
Edit
The method that I would recommend to better handle edge-cases is to use purpose-built bioinformatics software, e.g. seqkit
seqkit seq -m 50 -M 800 example.fasta
>4RYF_2
MNLIPTVIEQTSRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLDAQDPEKDI
FLYINSPGGSISAGMAIYDTMNFVKADVQTIGMGMAASMGSFLLTAGANGKRFALPNAEI
MIHQPLGGAQGQATEIEIAARHILKIKERMNTIMAEKTGQPYEVIARDTDRDNFMTAQEA
KDYGLIDDIIINKSGLKGHHHHHH
Is perl an option?
perl -nle '$prev && print if length() >50 and length() < 800 && print $prev; $prev = $_' input_file
$prev - Create a variable which will hold every line. When the length condition is met, and there has been a previous line $prev, then it prints the condition matched in $prev and prints the last line.
$prev = $_ Assigns the current line to the prev line variable
If the upper limit 800 is not essential, could sed be an option?
$ sed -En '/>/ {N;/[a-zA-Z0-9]{50,}/p}' input_file
/>/ - Match > and read into the pattern space
N; Run the condition on the next line after the match and append that to the pattern space also:
{50,} - If the length is 50 or more
\1/p - Return it and print
Output
>4RYF_2
MNLIPTVIEQTSRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLDAQDPEKDIFLYINSPGGSISAGMAIYDTMNFVKADVQTIGMGMAASMGSFLLTAGANGKRFALPNAEIMIHQPLGGAQGQATEIEIAARHILKIKERMNTIMAEKTGQPYEVIARDTDRDNFMTAQEAKDYGLIDDIIINKSGLKGHHHHHH
With your shown samples, please try following awk code. Written and tested with GNU awk.
awk -v RS= '
{
val=""
delete arr
while(match($0,/>[^\n]*\n*[^\n]*/)){
val=substr($0,RSTART,RLENGTH)
split(val,arr,"\n")
if(length(arr[2])>50 && length(arr[2])<=800){
print val
}
$0=substr($0,RSTART+RLENGTH)
}
}
' Input_file
If only the next line should meet the length restrictions, you can match and store the line that starts with > in a variable, for example previous
Then for the next line, check for the length and if the previous line is not empty.
If is is not, print the previous and the current line.
At the end, set the previous variable to an empty string.
awk '{
if (/^>/) {
previous = $0
next
}
if (length(previous) != 0 && length($0) > 50 && length($0) <= 800) {
print previous ORS $0
}
previous=""
}' sample.txt
See an AWK demo
I will like to duplicate each line 2 times and print values of column 5 and 6 separated.( transpose values of column 5 and 6 from column to row ) for each line
I mean value on column 5 (first line) value in column 6 ( second line)
Input File
08,1218864123180000,3201338573,VV,22,27
08,1218864264864000,3243738789,VV,15,23
08,1218864278580000,3244738513,VV,3,13
08,1218864310380000,3243938789,VV,15,23
08,1218864324180000,3244538513,VV,3,13
08,1218864334380000,3200538561,VV,22,27
Desired Output
08,1218864123180000,3201338573,VV,22
08,1218864123180000,3201338573,VV,27
08,1218864264864000,3243738789,VV,15
08,1218864264864000,3243738789,VV,23
08,1218864278580000,3244738513,VV,3
08,1218864278580000,3244738513,VV,13
08,1218864310380000,3243938789,VV,15
08,1218864310380000,3243938789,VV,23
08,1218864324180000,3244538513,VV,3
08,1218864324180000,3244538513,VV,13
08,1218864334380000,3200538561,VV,22
08,1218864334380000,3200538561,VV,27
I use this code to duplicate the lines 2 times, but i cant'n figer out the condition with values of column 5 and 6
awk '{print;print}' file
Thanks in advance
To repeatedly print the start of a line for each of the last N fields where N is 2 in this case:
$ awk -v n=2 '
BEGIN { FS=OFS="," }
{
base = $0
sub("("FS"[^"FS"]+){"n"}$","",base)
for (i=NF-n+1; i<=NF; i++) {
print base, $i
}
}
' file
08,1218864123180000,3201338573,VV,22
08,1218864123180000,3201338573,VV,27
08,1218864264864000,3243738789,VV,15
08,1218864264864000,3243738789,VV,23
08,1218864278580000,3244738513,VV,3
08,1218864278580000,3244738513,VV,13
08,1218864310380000,3243938789,VV,15
08,1218864310380000,3243938789,VV,23
08,1218864324180000,3244538513,VV,3
08,1218864324180000,3244538513,VV,13
08,1218864334380000,3200538561,VV,22
08,1218864334380000,3200538561,VV,27
In this simple case where the last field has to be removed and placed on the last line, you can do
awk -F , -v OFS=, '{ x = $6; NF = 5; print; $5 = x; print }'
Here -F , and -v OFS=, will set the input and output field separators to a comma, respectively, and the code does
{
x = $6 # remember sixth field
NF = 5 # Set field number to 5, so the last one won't be printed
print # print those first five fields
$5 = x # replace value of fifth field with remembered value of sixth
print # print modified line
}
This approach can be extended to handle fields in the middle with a function like the one in the accepted answer of this question.
EDIT: As Ed notes in the comments, writing to NF is not explicitly defined to trigger a rebuild of $0 (the whole-line record that print prints) in the POSIX standard. The above code works with GNU awk and mawk, but with BSD awk (as found on *BSD and probably Mac OS X) it fails to do anything.
So to be standards-compliant, we have to be a little more explicit and force awk to rebuild $0 from the modified field state. This can be done by assigning to any of the field variables $1...$NF, and it's common to use $1=$1 when this problem pops up in other contexts (for example: when only the field separator needs to be changed but not any of the data):
awk -F , -v OFS=, '{ x = $6; NF = 5; $1 = $1; print; $5 = x; print }'
I've tested this with GNU awk, mawk and BSD awk (which are all the awks I can lay my hands on), and I believe this to be covered by the awk bit in POSIX where it says "setting any other field causes the re-evaluation of $0" right at the top. Mind you, the spec could be more explicit on this point, and I'd be interested to test if more exotic awks behave the same way.
Could you please try following(considering that your Input_file always is same as shown and you need to print every time 1st four fields and then rest of the fields(one by one printing along with 1st four)).
awk 'BEGIN{FS=OFS=","}{for(i=5;i<=NF;i++){print $1,$2,$3,$4,$i}}' Input_file
This might work for you (GNU awk):
awk '{print gensub(/((.*,).*),/,"\\1\n\\2",1)}' file
Replace the last comma by a newline and the previous fields less the penultimate.
The Problem
I just need to combine a whole bunch of files and strip out the header (line 1) from the 1st file.
The Data
Here are the last three lines (with line 1: header) from three of these files:
"START_DATE","END_DATE","UNITS","COST","COST_CURRENCY","AMOUNT"
"20170101","20170131","1","5.49","EUR","5.49"
"20170101","20170131","1","4.27","EUR","4.27"
"","","","","9.76",""
"START_DATE","END_DATE","UNITS","COST","COST_CURRENCY","AMOUNT"
"20170201","20170228","1","5.49","EUR","5.49"
"20170201","20170228","1","4.88","EUR","4.88"
"20170201","20170228","1","0.61","EUR","0.61"
"20170201","20170228","1","0.61","EUR","0.61"
"","","","","11.59",""
START_DATE","END_DATE","UNITS","COST","COST_CURRENCY","AMOUNT"
"20170301","20170331","1","4.88","EUR","4.88"
"20170301","20170331","1","4.27","EUR","4.27"
"","","","","9.15",""
Problem (Continued)
As you can see, the last line has a number (it's a column total) in column 5. Of course, I don't want that last line. But it's (obviously) on a different line number in each file.
(G)awk is clearly the solution, but I don't know (g)awk.
What I've Tried
I've tried a number of combinations of things, but I guess the one that I'm most surprised does not work is:
gawk '
{ if (!$1 ) nextfile }
NR == 1 {$0 = "Filename" "StartDate" OFS $0; print}
FNR > 1 {$0 = FILENAME StartDate OFS $0; print}
' OFS=',' */*.csv > ../path/file.csv
Expected Output (by request)
"START_DATE","END_DATE","UNITS","COST","COST_CURRENCY","AMOUNT
20170101","20170131","1","5.49","EUR","5.49
20170101","20170131","1","4.27","EUR","4.27
20170201","20170228","1","5.49","EUR","5.49
20170201","20170228","1","4.88","EUR","4.88
20170201","20170228","1","0.61","EUR","0.61
20170201","20170228","1","0.61","EUR","0.61
20170301","20170331","1","4.88","EUR","4.88
20170301","20170331","1","4.27","EUR","4.27"
And, of course, I've tried searching both Google and SO. Most of the answers I see require much more awk knowledge than I have, just to understand them. (I'm not a data wrangler, but I have a data wrangling task.)
Thanks for any help!
this should do...
awk 'NR==1; FNR==1{next} FNR>2{print p} {p=$0}' file{1..3}
print first header, skip other headers and last lines.
Another awk approach:-
awk -F, '
NR == 1 {
header = $0
print
next
}
FNR > 1 && $1 != "\"\""
' *.csv
Something like the following should do the trick:
awk -F"," 'NR==1{header=$0; print $0} $0!=header && $1!=""{print $0}' */*.csv > ../path/file.csv\
Here awk will:
Split the records by comma -F","
If this is the first record awk encounters, it sets variable header to the entire contents of the line and then prints the header NR==1{header=$0; print $0}
If the contents of the current line are not a header and the first field isn't empty (indicating a "total" line), then print the line $0!=header && $1!=""{print $0}'
As mentioned in my comment below, if the first field of your records always begin with an 8 digit date, then you could simplify (this is less generic than the code above):
awk -F"," 'NR == 1 || $1 ~ /"[0-9]{8}"/ {print $0} /*.csv > outfile.csv
Essentially that says if this is the first record to process then print it (it's a header) OR || if the first field is an 8 digit number surrounded by double quotes then print it.
I have two columns like this:
(A) (B)
Adam 30
Jon 55
Robert 35
Jokim 99
Adam 32
Adam 31
Jokim 88
I want an AWK script to check if Adam( or any name ) in column A becomes 30 in column B then delete all Adam names from column A, it does not matter whether Adam becomes 31 or 32 later, and then print the results.
I have a log list in reality and I do not want the code to be depended on "Adam". So, What I want exactly is basically wherever 30 is existed in $2 so delete the respective value in $1 and also search in $1 to find all values which are the same as the deleted value.
You can read the columns into variables and check the value of the second column for the value you are looking for then sed the file to delete all the column 1 entries:
cp test.txt out.txt && CHK=30 && while read a b; do
[ "${b}" = "${CHK}" ] && sed -i "/^${a}/d" out.txt
done < test.txt
Note: If you may have regex values in the columns you may need to escape them, also if you possibly have blanks you may want to check for null first before the test on column 2.
And since you specified AWK here is a somewhat elegant awk way to do this, using a check flag to look ahead prior to printing:
awk -vCHK=30 '{if($2~CHK)block=$1; if($1!=block)print}' test.txt
To remove the entries from the first occurence of Adam, 30:
$1 == "Adam" && $2 == 30 { found = 1 }
!(found && $1 == "Adam")
To remove all Adam entries if any Adam, 30 exists:
$1 == "Adam" && $2 == 30 { found = 1 }
!(found && $1 == "Adam") { lines[nlines++] = $0 }
END { for (i in lines) print lines[i] }
To remove all names which have a 30 the second column:
NR == FNR && $2 == 30 { foundnames[$1] = 1 }
NR != FNR && !($1 in foundnames)
You must call this last version with the input filename twice, ie awk process.awk file.txt file.txt
I am beginner in AWK, so please help me to learn it. I have a text file with name snd and it values are
1 0 141
1 2 223
1 3 250
1 4 280
I want to print the entire row when the third column value is minimu
This should do it:
awk 'NR == 1 {line = $0; min = $3}
NR > 1 && $3 < min {line = $0; min = $3}
END{print line}' file.txt
EDIT:
What this does is:
Remember the 1st line and its 3rd field.
For the other lines, if the 3rd field is smaller than the min found so far, remember the line and its 3rd field.
At the end of the script, print the line.
Note that the test NR > 1 can be skipped, as for the 1st line, $3 < min will be false. If you know that the 3rd column is always positive (not negative), you can also skip the NR == 1 ... test as min's value at the beginning of the script is zero.
EDIT2:
This is shorter:
awk 'NR == 1 || $3 < min {line = $0; min = $3}END{print line}' file.txt
You don't need awk to do what you want. Use sort
sort -nk 3 file.txt | head -n 1
Results:
1 0 141
I think sort is an excellent answer, unless for some reason what you're looking for is the awk logic to do this in a larger script, or you want to avoid the extra pipes, or the purpose of this question is to learn more about awk.
$ awk 'NR==1{x=$3;line=$0} $3<x{line=$0} END{print line}' snd
Broken out into pieces, this is:
NR==1 {x=$3;line=$0} -- On the first line, set an initial value for comparison and store the line.
$3<x{line=$0} - On each line, compare the third field against our stored value, and if the condition is true, store the line. (We could make this run only on NR>1, but it doesn't matter.
END{print line} -- At the end of our input, print whatever line we've stored.
You should read man awk to learn about any parts of this that don't make sense.
a short answer for this would be:
sort -k3,3n temp|head -1
since you have asked for awk:
awk '{if(min>$3||NR==1){min=$3;a[$3]=$0}}END{print a[min]}' your_file
But i prefer the shorter one always.
For calculating the smallest value in any column , let say last column
awk '(FNR==1){a=$NF} {a=$NF < a?$NF:a} END {print a}'
this will only print the smallest value of the column.
In case if complete line is needed better to use sort:
sort -r -n -t [delimiter] -k[column] [file name]
awk -F ";" '(NR==1){a=$NF;b=$0} {a=$NF<a?$NF:a;b=$NF>a?b:$0} END {print b}' filename
this will print the line with smallest value which is encountered first.
awk 'BEGIN {OFS=FS=","}{if ( a[$1]>$2 || a[$1]=="") {a[$1]=$2;} if (b[$1]<$2) {b[$1]=$2;} } END {for (i in a) {print i,a[i],b[i]}}' input_file
We use || a[$1]=="" because when 1st value of field 1 is encountered it will have null in a[$1].